ACTH (1-39), rat (Echelon Product Code: 115-10 1MG)
| Description: | CAS Number: 77465-10-2 Molecular Weight: 4579.33 Salt Form: TFA Purity: 96% Sequence (3-letter): Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH Sequence (1-letter): SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF-OH Storage: -20 °C or below ACTH (1-39), full name adenocorticotropic hormone, is a peptide hormone also known as corticotropin. ACTH is secreted by the anterior pituitary gland and is often produced in response to stress. ACTH controls the release of glucocorticoid hormones and enhances the transcription of mitochondial genes for oxidative phosphorylation. ACTH is formed by cleavage of POMC (proopimelanocortin). The rat homolog is 95% identical to the human peptide. |
| Order #: | ECH-115-10-1MG |
| Unit Size: | 1 mg |
| Supplier: | Echelon Biosciences |
| Restrictions: | Available in all European countries, except France & Italy. |
| Shipping: | Room Temperature |
| Storage: | -20 °C or below |
| Subcategory: | Peptides |
| More information: | Go to webpage |
Add to request list
- Phone: +49 (0)89 3799666-6
- E-mail: info@biozol.de
MoBiTec is now part of BIOZOL
All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.
Technical Service - Product Information
Viewed