mobitec-globe Innovative Tools for Molecular and Cell Biology

Calcitonin Gene Related Peptide II (8-37), human / Beta CGRP (Echelon Product Code: 231-22 1MG)

Calcitonin Gene Related Peptide II (8-37), human / Beta CGRP (Echelon Product Code: 231-22 1MG)
Description: CAS Number: 119911-68-1 Molecular Weight: 3128.71 Salt Form: TFA Purity: 95% Sequence (3-letter): Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 Sequence (1-letter): VTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 Storage: -20 °C or below Calcitonin Gene Related Peptide (CGRP) (8-37) acts as an antagonist against CGRP receptors but not calcitonin receptors. Calcitonin Gene Related Peptide (CGRP) is produced in central and peripheral neurons and binds to the herterodimeric CGRP receptors found throughout the body. It has roles in modulating the autonomic nervous system, appetite suppression, gastric acid release, temperature homeostasis, and heart rate. CGRP exists in two forms CGRP I (CGRP-") and CGRP II (CGRP-")
Order #: ECH-231-22-1MG
Unit Size: 1 mg
Supplier: Echelon Biosciences
Restrictions: Available in all European countries, except France & Italy.
Shipping: Room Temperature
Storage: -20 °C or below
Subcategory: Peptides
More information: Go to webpage
Flyer or Brochure Product Image
Add to request list
    MoBiTec is now part of BIOZOL

    All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
    You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.

    Technical Service - Product Information
Viewed