mobitec-globe Innovative Tools for Molecular and Cell Biology

Calcitonin, salmon (Echelon Product Code: 237-26 5MG)

Calcitonin, salmon (Echelon Product Code: 237-26 5MG)
Description: CAS Number: 47931-85-1 Molecular Weight: 3431.74 Salt Form: Acetate Purity: 96% Sequence (3-letter): Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Cys1-Cys7) Sequence (1-letter): CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 Storage: -20 °C or below Solubility: 1% acetic acid to 1 mg/mL Calcitonin is cyclic peptide hormone that stimulates bone formation by osteoblasts and inhibits bone resorption. Calcitonin is a hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of non-mammalian vertebrates. It decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. Salmon calcitonin is more potent than mammalian forms. » References 1.Chestnut, C.H. et al. (2000) "A randomized trial of nasal spray salmon calcitonin in postmenopausal women with established osteoporosis: the prevent recurrence of osteoporotic fractures study" Am. J. Med. 109 (4): 267"276. 2.Manicourt, D.-H. et al. (2006) "Oral salmon calcitonin reduces Lequesne's algofunctional index scores and decreases urinary and serum levels of biomarkers of joint metabolism in knee osteoarthritis" Arthritis Rheum. 54 (10): 3205-3211.
Order #: ECH-237-26-5MG
Unit Size: 5 mg
Supplier: Echelon Biosciences
Restrictions: Available in all European countries, except France & Italy.
Shipping: Room Temperature
Storage: -20 °C or below
Subcategory: Peptides
More information: Go to webpage
Flyer or Brochure Product Image
Add to request list
    MoBiTec is now part of BIOZOL

    All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
    You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.

    Technical Service - Product Information
Viewed