Calcitonin, salmon [Des-Cys1] (Echelon Product Code: 237-34 1MG)
| Description: | Molecular Weight: 3328.73 Salt Form: TFA Purity: 95% Sequence (3-letter): Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 Sequence (1-letter): SNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 Storage: -20 °C or below Calcitonin is cyclic peptide hormone that stimulates bone formation by osteoblasts and inhibits bone resorption. Calcitonin is a hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of non-mammalian vertebrates. It decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. Salmon calcitonin is more potent than mammalian forms. Calcitonin, salmon [Des-Cys1] is an analog in which the N-terminal Cys has been replaced with Ser. |
| Order #: | ECH-237-34-1MG |
| Unit Size: | 1 mg |
| Supplier: | Echelon Biosciences |
| Restrictions: | Available in all European countries, except France & Italy. |
| Shipping: | Room Temperature |
| Storage: | -20 °C or below |
| Subcategory: | Peptides |
| More information: | Go to webpage |
Add to request list
- Phone: +49 (0)89 3799666-6
- E-mail: info@biozol.de
MoBiTec is now part of BIOZOL
All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.
Technical Service - Product Information
Viewed