mobitec-globe Innovative Tools for Molecular and Cell Biology

Prodynorphin 228-256 (porcine) (Dynorphin B 29, Leumorphin) (Echelon Product Code: 274-56 0.5MG)

Prodynorphin 228-256 (porcine) (Dynorphin B 29, Leumorphin) (Echelon Product Code: 274-56 0.5MG)
Description: Molecular Weight: 3525.73 Salt Form: TFA Purity: 96% Sequence (3-letter): Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr-Arg-Ser-Gln-Glu-Asp-Pro-Asn-Ala-Tyr-Tyr-Glu-Glu-Leu-Phe-Asp-Val-OH Sequence (1-letter): YGGFLRRQFKVVTRSQEDPNAYYEELFDV-OH Storage: -20 °C or below Leumorphin, porcine which corresponds to the 228-256 fragment of Preproenkephalin B. It is also known as Dynorphin B29 and Prodynorphin 228-256. Leumorphin is potent and selective "-opioid receptor agonist. The porcine form of Leumorphin differs by 3 amino acids from the human form.
Order #: ECH-274-56-0.5MG
Unit Size: 0.5 mg
Supplier: Echelon Biosciences
Restrictions: Available in all European countries, except France & Italy.
Shipping: Room Temperature
Storage: -20 °C or below
Subcategory: Peptides
More information: Go to webpage
Flyer or Brochure Product Image
225.00 € *

*All prices are net in Euro and do not include applicable taxes, shipping & handling, or other charges (e.g., customs duties).

Delivery time approx. 8 - 10 working days

    How To Order

    Orders can be placed by phone, fax, e-mail, or via our online shop:

    MoBiTec is now part of BIOZOL

    All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
    You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.

    Technical Service - Product Information
Viewed