mobitec-globe Innovative Tools for Molecular and Cell Biology

Beta Endorphin, human / Beta Lipotropin (61-91), human (Echelon Product Code: 291-25 1MG)

Beta Endorphin, human / Beta Lipotropin (61-91), human (Echelon Product Code: 291-25 1MG)
Description: CAS Number: 61214-51-5 Molecular Weight: 3465.05 Salt Form: TFA Purity: 95% Sequence (3-letter): Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OH Sequence (1-letter): YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE-OH Storage: -20 °C or below Beta Lipotropin (61-91) is a precusor for Beta Endorphin, an endogenous neuropeptide which acts as an agonist for opioid receptors. Beta Endorphin binds strongly to " receptors in brain and by " and " receptors in the spinal cord and is released in response to painful stimuli and is studied for its effects on pain perception (nociception). It is found in the hypothalmus and pituitary gland and is formed by cleavage of the C-terminal region of "-lipotropin.
Order #: ECH-291-25-1MG
Unit Size: 1 mg
Supplier: Echelon Biosciences
Restrictions: Available in all European countries, except France & Italy.
Shipping: Room Temperature
Storage: -20 °C or below
Subcategory: Peptides
More information: Go to webpage
Flyer or Brochure Product Image
Add to request list
    MoBiTec is now part of BIOZOL

    All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
    You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.

    Technical Service - Product Information
Viewed