Description: | CAS Number: 61214-51-5 Molecular Weight: 3465.05 Salt Form: TFA Purity: 95% Sequence (3-letter): Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OH Sequence (1-letter): YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE-OH Storage: -20 °C or below Beta Lipotropin (61-91) is a precusor for Beta Endorphin, an endogenous neuropeptide which acts as an agonist for opioid receptors. Beta Endorphin binds strongly to " receptors in brain and by " and " receptors in the spinal cord and is released in response to painful stimuli and is studied for its effects on pain perception (nociception). It is found in the hypothalmus and pituitary gland and is formed by cleavage of the C-terminal region of "-lipotropin. |
Order #: | ECH-291-25-1MG |
Unit Size: | 1 mg |
Supplier: | Echelon Biosciences |
Restrictions: | Available in all European countries, except France & Italy. |
Shipping: | Room Temperature |
Storage: | -20 °C or below |
Subcategory: | Peptides |
More information: | Go to webpage |
Add to request list
- Phone: +49 (0)89 3799666-6
- E-mail: info@biozol.de
MoBiTec is now part of BIOZOL
All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.
Technical Service - Product Information
Viewed