mobitec-globe Innovative Tools for Molecular and Cell Biology

Adrenomedullin (1-50), rat (Echelon Product Code: 335-75 0.5MG)

Adrenomedullin (1-50), rat (Echelon Product Code: 335-75 0.5MG)
Description: CAS Number: 159964-38-2 Molecular Weight: 5727.72 Salt Form: TFA Purity: 96% Sequence (3-letter): Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 [Cys14-Cys19] Sequence (1-letter): YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 Storage: -20 °C or below Adrenomedullin (ADM) is a peptide hormone isolated in 1993 from a pheochromocytoma, a tumor of the adrenal medulla. ADM has roles in tumor progression, regulating endometrial angiogenesis, hypertension, and cardiovascualar disease.
Order #: ECH-335-75-0.5MG
Unit Size: 0.5 mg
Supplier: Echelon Biosciences
Restrictions: Available in all European countries, except France & Italy.
Shipping: Room Temperature
Storage: -20 °C or below
Subcategory: Peptides
More information: Go to webpage
Flyer or Brochure Product Image
Add to request list
    MoBiTec is now part of BIOZOL

    All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
    You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.

    Technical Service - Product Information
Viewed