PACAP (1-38), ovine, human (Echelon Product Code: 350-35 1MG)
| Description: | CAS Number: 137061-48-4 Molecular Weight: 4531.5 Salt Form: TFA Purity: 95% Sequence (3-letter): His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2 Sequence (1-letter): HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 Storage: -20 °C or below Pituitary adenylate cyclase-activating polypeptide (PACAP) stimulates adenylate cyclase and increases cAMP levels in cells. It is primarily expressed in nervous tissues and has high homology to vasoactive intestinal peptide (VIP). PACAP exists as 38- or 27-amino acid forms though the 1-38 form is predominant. PACAP binds to PAC1-R, VPAC1-R, and VPAC2-R receptors. PACAP functions as a neurotransmitter and neuromodulator. |
| Order #: | ECH-350-35-1MG |
| Unit Size: | 1 mg |
| Supplier: | Echelon Biosciences |
| Restrictions: | Available in all European countries, except France & Italy. |
| Shipping: | Room Temperature |
| Storage: | -20 °C or below |
| Subcategory: | Peptides |
| More information: | Go to webpage |
Add to request list
- Phone: +49 (0)89 3799666-6
- E-mail: info@biozol.de
MoBiTec is now part of BIOZOL
All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.
Technical Service - Product Information
Viewed