Charybdotoxin (Echelon Product Code: 429-60 0.1MG)
| Description: | CAS Number: 95751-30-7Molecular Weight: 4298.92Salt Form: TFAPurity: >95%Sequence (3-letter): Glp-Phe-Thr-Asn-Val-Ser-Cys-Thr-Thr-Ser-Lys-Glu-Cys-Trp-Ser-Val-Cys-Gln-Arg-Leu-His-Asn-Thr-Ser-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser-OH [Cys7-Cys28 Cys13-Cys33 Cys17-35]Sequence (1-letter): (Glp)FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS-OHStorage: -20 °C or belowCharybdotoxin is a potent neurotoxin isolated from the deathstalker scorpion Leiurus quinquestriatus hebraeus. Charybdotoxin depolarizes peripheral T lymphocytes by binding to Ca2+-activated K+ channels and blocks their mitogen-induced proliferation. |
| Order #: | ECH-429-60-0.1MG |
| Unit Size: | 0.1 mg |
| Supplier: | Echelon Biosciences |
| Restrictions: | Available in all European countries, except France & Italy. |
| Shipping: | Room Temperature |
| Storage: | -20 °C or below |
| Subcategory: | Peptides |
| More information: | Go to webpage |
249.00 € *
*All prices are net in Euro and do not include applicable taxes, shipping & handling, or other charges (e.g., customs duties).
Delivery time approx. 8 - 10 working days
- Phone: +49 (0)89 3799666-6
- Fax: +49 (0)89 3799666-99
- E-mail: order@biozol.de
- Online Shop: www.mobitec.com
- Phone: +49 (0)89 3799666-6
- E-mail: info@biozol.de
How To Order
Orders can be placed by phone, fax, e-mail, or via our online shop:
MoBiTec is now part of BIOZOL
All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.
Technical Service - Product Information
Viewed