mobitec-globe Innovative Tools for Molecular and Cell Biology

Decorsin, Leech (Macrobdella decora) (Echelon Product Code: 459-10 1MG)

Decorsin, Leech (Macrobdella decora) (Echelon Product Code: 459-10 1MG)
Description: Molecular Weight: 4380.85 Salt Form: TFA Purity: 95% Sequence (3-letter): Ala-Pro-Arg-Leu-Pro-Gln-Cys-Gln-Gly-Asp-Asp-Gln-Glu-Lys-Cys-Leu-Cys-Asn-Lys-Asp-Glu-Cys-Pro-Pro-Gly-Gln-Cys-Arg-Phe-Pro-Arg-Gly-Asp-Ala-Asp-Pro-Tyr-Cys-Glu-OH (Cys-7-Cys15, Cys17-Cys27, Cys22-Cys38) Sequence (1-letter): APRLPQCQGDDQEKCLCNKDECPPGQCRFPRGDADPYCE-OH Storage: -20 °C or below Decorsin is a peptide isolated from the North American leech Macrobdella decora. It is a potent inhibitor of platelet aggregation by acting as an antagonist of platelet glycoprotein IIb-IIIa (GPIIb-IIIa) (IC50 = 1.5 nM). Seymour JL, Henzel WJ, Nevins B, Stults JT, Lazarus RA. Decorsin. A potent glycoprotein IIb-IIIa antagonist and platelet aggregation inhibitor from the leech Macrobdella decora. J Biol Chem. 1990 Jun 15;265(17):10143-7. PMID: 2351655.
Order #: ECH-459-10-1MG
Unit Size: 1 mg
Supplier: Echelon Biosciences
Restrictions: Available in all European countries, except France & Italy.
Shipping: Room Temperature
Storage: -20 °C or below
Subcategory: Peptides
More information: Go to webpage
Flyer or Brochure Product Image
Add to request list
    MoBiTec is now part of BIOZOL

    All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
    You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.

    Technical Service - Product Information
Viewed