mobitec-globe Innovative Tools for Molecular and Cell Biology

GLP 2 [Tyr34] (1-34), human (Echelon Product Code: 471-19 0.5MG)

GLP 2 [Tyr34] (1-34), human (Echelon Product Code: 471-19 0.5MG)
Description: Molecular Weight: 3926.89 Salt Form: TFA Purity: 95% Sequence (3-letter): His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Tyr-OH Sequence (1-letter): HADGSFSDEMNTILDNLAARDFINWLIQTKITDY-OH Storage: -20 °C or below Glucagon-like Peptide-2 (GLP-2) is a 33-amino acid peptide formed through post-translational proteolytic cleavage of proglucagon. GLP-2 produces a number of effects when administered to humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. This analog of GLP-2 with a C-terminal Tyr can be iodinated with (125)I and used as a tracer.
Order #: ECH-471-19-0.5MG
Unit Size: 0.5 mg
Supplier: Echelon Biosciences
Restrictions: Available in all European countries, except France & Italy.
Shipping: Room Temperature
Storage: -20 °C or below
Subcategory: Peptides
More information: Go to webpage
Flyer or Brochure Product Image
Add to request list
    MoBiTec is now part of BIOZOL

    All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
    You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.

    Technical Service - Product Information
Viewed