| Description: | Molecular Weight: 3926.89 Salt Form: TFA Purity: 95% Sequence (3-letter): His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Tyr-OH Sequence (1-letter): HADGSFSDEMNTILDNLAARDFINWLIQTKITDY-OH Storage: -20 °C or below Glucagon-like Peptide-2 (GLP-2) is a 33-amino acid peptide formed through post-translational proteolytic cleavage of proglucagon. GLP-2 produces a number of effects when administered to humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. This analog of GLP-2 with a C-terminal Tyr can be iodinated with (125)I and used as a tracer. |
| Order #: | ECH-471-19-1MG |
| Unit Size: | 1 mg |
| Supplier: | Echelon Biosciences |
| Restrictions: | Available in all European countries, except France & Italy. |
| Shipping: | Room Temperature |
| Storage: | -20 °C or below |
| Subcategory: | Peptides |
| More information: | Go to webpage |
Add to request list
- Phone: +49 (0)89 3799666-6
- E-mail: info@biozol.de
MoBiTec is now part of BIOZOL
All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.
Technical Service - Product Information
Viewed