Glucagon-like Peptide-2 (GLP-2) (1-33), rat (Echelon Product Code: 471-23 1MG)
| Description: | CAS Number: 195262-56-7 Molecular Weight: 3793.84 Salt Form: TFA Purity: 95% Sequence (3-letter): His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH Sequence (1-letter): HADGSFSDEMNTILDNLATRDFINWLIQTKITD-OH Storage: -20 °C or below Glucagon-like peptide-2 (GLP-2, Preproglucagon (126-158)) is a 33 amino acid peptide which is formed by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced in gut endocrine cells and certain neuronal cells in the central nervous system. Administration of GLP-2 demos demonstrates cytoprotective and reparative effects in rodent models of intestinal injury. An analog of Glucagon-like peptide-2, Teduglutide;, is used as a treatment for short-bowel syndrome by increasing nutrient absorption. |
| Order #: | ECH-471-23-1MG |
| Unit Size: | 1 mg |
| Supplier: | Echelon Biosciences |
| Restrictions: | Available in all European countries, except France & Italy. |
| Shipping: | Room Temperature |
| Storage: | -20 °C or below |
| Subcategory: | Peptides |
| More information: | Go to webpage |
Add to request list
- Phone: +49 (0)89 3799666-6
- E-mail: info@biozol.de
MoBiTec is now part of BIOZOL
All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.
Technical Service - Product Information
Viewed