| Description: | CAS Number: 88813-36-9 Molecular Weight: 3208.63 Salt Form: TFA Purity: 96% Sequence (3-letter): Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala-NH2 Sequence (1-letter): GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2 Storage: -20 °C or below Galanin is a neuropeptide first isolated from the porcine small intestine. It has a variety of biologic effects in the digestive system via the GAL1-3 receptors, including inhibiting the secretion of somatostatin, insulin, and glucose. |
| Order #: | ECH-471-25-0.5MG |
| Unit Size: | 0.5 mg |
| Supplier: | Echelon Biosciences |
| Restrictions: | Available in all European countries, except France & Italy. |
| Shipping: | Room Temperature |
| Storage: | -20 °C or below |
| Subcategory: | Peptides |
| More information: | Go to webpage |
Add to request list
- Phone: +49 (0)89 3799666-6
- E-mail: info@biozol.de
MoBiTec is now part of BIOZOL
All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.
Technical Service - Product Information
Viewed