Description: | CAS Number: 99658-04-5 Molecular Weight: 4109.02 Salt Form: TFA Purity: 95% Sequence (3-letter): His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 Sequence (1-letter): HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 Storage: -20 °C or below Glucagon-like peptide-1 (GLP-1, Preproglucagon 72-107) is an incretin produced primarily in ileal L cells. GLP-1 secretion by these cells is dependent on the presence of nutrients in the lumen of the small intestine. GLP-1 promotes satiety and sustained GLP-1-receptor activation correlates with weight loss. The biologically active forms of GLP-1 are GLP-1 (7-37) and GLP-1 (7-36)NH2 (cat # 471-39; and 471-28;, respectively) which are produced as a result of selective cleavage of proglucagon. |
Order #: | ECH-471-27-1MG |
Unit Size: | 1 mg |
Supplier: | Echelon Biosciences |
Restrictions: | Available in all European countries, except France & Italy. |
Shipping: | Room Temperature |
Storage: | -20 °C or below |
Subcategory: | Peptides |
More information: | Go to webpage |
Add to request list
- Phone: +49 (0)89 3799666-6
- E-mail: info@biozol.de
MoBiTec is now part of BIOZOL
All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.
Technical Service - Product Information
Viewed