Glucagon-like Peptide-1 (GLP-1) (7-36) / Preproglucagon (78-107) amide (Echelon Product Code: 471-28 0.5MG)
| Description: | CAS Number: 107444-51-9 Molecular Weight: 3297.69 Salt Form: TFA Purity: 95% Sequence (3-letter): His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 Sequence (1-letter): HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 Storage: -20 °C or below Glucagon-like Peptide-1 (7-36) is one the two primary biologically active forms of secreted glucagon-like peptide-1 (GLP-1). GLP-1 is secreted as a pro-peptide that is then proteolytically cleaved into two active forms, (7-37) and (7-36). These active peptides can promote insulin secretion in a glucose-dependent manner. |
| Order #: | ECH-471-28-0.5MG |
| Unit Size: | 0.5 mg |
| Supplier: | Echelon Biosciences |
| Restrictions: | Available in all European countries, except France & Italy. |
| Shipping: | Room Temperature |
| Storage: | -20 °C or below |
| Subcategory: | Peptides |
| More information: | Go to webpage |
Add to request list
- Phone: +49 (0)89 3799666-6
- E-mail: info@biozol.de
MoBiTec is now part of BIOZOL
All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.
Technical Service - Product Information
Viewed