mobitec-globe Innovative Tools for Molecular and Cell Biology

Glucagon, human (Echelon Product Code: 471-30 0.5MG)

Glucagon, human (Echelon Product Code: 471-30 0.5MG)
Description: CAS Number: 9007-92-5, 16941-32-5 Molecular Weight: 3480.63 Salt Form: TFA Purity: 95% Sequence (3-letter): His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-OH Sequence (1-letter): HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-OH Storage: -20 °C or below Solubility: 5 mg/ml in water Glucagon is a peptide hormone produced by the pancreas that opposes the action of insulin in peripheral tissues, predominantly the liver, where the insulin:glucagon ratio determines the intricate control of gluconeogenesis and glycogenolysis. The action of glucagon in the liver is complex and involves coordinate regulation of transcription factors and signal transduction networks which converge on regulation of amino acid, lipid and carbohydrate metabolism. It is also known to regulate the rate of glucose production, notably under conditions of insulin suppression, such as Diabetes mellitus. » References 1.Creutzfeldt W. The incretin concept today. Diabetologia. 1979 Feb;16(2):75"85. 2. Kimball, S.R. et al (2004) "Glucagon represses signaling through the mammalian target of rapamycin in rat liver by activating AMP-activated protein kinase" J. Biol. Chem. 279 (52): 54103-54109.
Order #: ECH-471-30-0.5MG
Unit Size: 0.5 mg
Supplier: Echelon Biosciences
Restrictions: Available in all European countries, except France & Italy.
Shipping: Room Temperature
Storage: -20 °C or below
Subcategory: Peptides
More information: Go to webpage
Flyer or Brochure Product Image
Add to request list
    MoBiTec is now part of BIOZOL

    All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
    You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.

    Technical Service - Product Information
Viewed