Oxyntomodulin (Glucagon-37) (Echelon Product Code: 471-33 1MG)
| Description: | CAS Number: 74870-06-7 Molecular Weight: 4419.17 Salt Form: TFA Purity: 95% Sequence (3-letter): His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala-OH Sequence (1-letter): HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA-OH Storage: -20 °C or below Oxyntomodulin, aka Glucagon-37, is a potent inhibitor of gastric acid secretion and pancreatic enzyme secretion. Oxyntomodulin injected directly into the hypothalamic paraventricular nucleus has been show to inhibit food intake in fasted and nonfasted animals in a potent and sustained manner. |
| Order #: | ECH-471-33-1MG |
| Unit Size: | 1 mg |
| Supplier: | Echelon Biosciences |
| Restrictions: | Available in all European countries, except France & Italy. |
| Shipping: | Room Temperature |
| Storage: | -20 °C or below |
| Subcategory: | Peptides |
| More information: | Go to webpage |
Add to request list
- Phone: +49 (0)89 3799666-6
- E-mail: info@biozol.de
MoBiTec is now part of BIOZOL
All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.
Technical Service - Product Information
Viewed