mobitec-globe Innovative Tools for Molecular and Cell Biology

Gastrin Releasing Peptide (GRP), human (Echelon Product Code: 471-85 1MG)

Gastrin Releasing Peptide (GRP), human (Echelon Product Code: 471-85 1MG)
Description: CAS Number: 93755-85-2 Molecular Weight: 2857.52 Salt Form: TFA Purity: 96% Sequence (3-letter): Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2 Sequence (1-letter): VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2 Storage: -20 °C or below Gastrin Releasing Peptide, human, is a ligand for the GRP receptor and is expressed in a subtype of peptidergic dorsal root ganglion neurons. GRP stimulates pepsinogen release and has also been identified as a tumor marker in the diagnosis of small-cell lung carcinoma. GRP is the mammalian analog of Bombesin.
Order #: ECH-471-85-1MG
Unit Size: 1 mg
Supplier: Echelon Biosciences
Restrictions: Available in all European countries, except France & Italy.
Shipping: Room Temperature
Storage: -20 °C or below
Subcategory: Peptides
More information: Go to webpage
Flyer or Brochure Product Image
Add to request list
    MoBiTec is now part of BIOZOL

    All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
    You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.

    Technical Service - Product Information
Viewed