PHI, rat (Echelon Product Code: 495-25 0.5MG)
| Description: | CAS Number: 96849-38-6 Molecular Weight: 3009.6 Salt Form: TFA Purity: 96% Sequence (3-letter): His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Tyr-Ser-Arg-Leu-Leu-Gly-Gln-Ile-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Ile-NH2 Sequence (1-letter): HADGVFTSDYSRLLGQISAKKYLESLI-NH2 Storage: -20 °C or below PHI, aka Intestinal peptide PHI-27, is a member of the vasoactive intestinal peptide (VIP) family of peptides. It is has been shown to regulate feeding behavior and prolactin secretion. |
| Order #: | ECH-495-25-0.5MG |
| Unit Size: | 0.5 mg |
| Supplier: | Echelon Biosciences |
| Restrictions: | Available in all European countries, except France & Italy. |
| Shipping: | Room Temperature |
| Storage: | -20 °C or below |
| Subcategory: | Peptides |
| More information: | Go to webpage |
Add to request list
- Phone: +49 (0)89 3799666-6
- E-mail: info@biozol.de
MoBiTec is now part of BIOZOL
All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.
Technical Service - Product Information
Viewed