Metastin, KISS-1 (68-121) (Echelon Product Code: 548-25 1MG)
| Description: | CAS Number: 374683-24-6 Molecular Weight: 5857.53 Salt Form: TFA Purity: 96% Sequence (3-letter): Gly-Thr-Ser-Leu-Ser-Pro-Pro-Pro-Glu-Ser-Ser-Gly-Ser-Arg-Gln-Gln-Pro-Gly-Leu-Ser-Ala-Pro-His-Ser-Arg-Gln-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2 Sequence (1-letter): GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 Storage: -20 °C or below Metastin, also known as Kisspeptin-54, is a potent endogenous ligand of the kisspeptin receptor GPR54 (KISS1R). It has various functions including increasing the release of aldosterone and GnRH and can act as a tumor suppressor by inhibiting chemotaxis, invasion and metastasis. |
| Order #: | ECH-548-25-1MG |
| Unit Size: | 1 mg |
| Supplier: | Echelon Biosciences |
| Restrictions: | Available in all European countries, except France & Italy. |
| Shipping: | Room Temperature |
| Storage: | -20 °C or below |
| Subcategory: | Peptides |
| More information: | Go to webpage |
Add to request list
- Phone: +49 (0)89 3799666-6
- E-mail: info@biozol.de
MoBiTec is now part of BIOZOL
All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.
Technical Service - Product Information
Viewed