mobitec-globe Innovative Tools for Molecular and Cell Biology

Neuropeptide Y (human, rat) (Echelon Product Code: 611-26 0.5MG)

Neuropeptide Y (human, rat) (Echelon Product Code: 611-26 0.5MG)
Description: CAS Number: 90880-35-6 Molecular Weight: 4271.76 Salt Form: TFA Purity: 96% Sequence (3-letter): Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 Sequence (1-letter): YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 Storage: -20 °C or below Solubility: water 1 mg/mL Neuropeptide Y (NPY) is a peptide that is abundant in the central and peripheral nervous system that plays a major role in controlling appetite, blood pressure, cardiac contractility, and intestinal secretion. NPY is a vasonconstrictor that inhibits Ca2+-activated K+ channels in vascular smooth muscle. Inhibition of NPY synthesis regulates food intake and metabolism implicating a role in obesity. This NPY amino acid sequence is homologous for human, rat, rabbit, and guinea pig. » References 1. Tatemoto, K., Carlquist, M. and Mutt, V. (1982) "Neuropeptide Y-a novel brain peptide with structural similarities to peptide YY and pancreatic polypeptide" Nature 296: 659-660. 2. a Stephens, T.W. et al. (2002) "The role of neuropeptide Y in the antiobesity action of the obese gene product" Nature 377: 530-532; 3.O"Barr, S. and Cooper, N.R. (2000) "The C5a complement activation peptide increases IL-1" and IL-6 release from amyloid-" primed human monocytes: implications for Alzheimer"s disease" J. Neuroimmunol. 109: 87"94.
Order #: ECH-611-26-0.5MG
Unit Size: 0.5 mg
Supplier: Echelon Biosciences
Restrictions: Available in all European countries, except France & Italy.
Shipping: Room Temperature
Storage: -20 °C or below
Subcategory: Peptides
More information: Go to webpage
Flyer or Brochure Product Image
Add to request list
    MoBiTec is now part of BIOZOL

    All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
    You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.

    Technical Service - Product Information
Viewed