mobitec-globe Innovative Tools for Molecular and Cell Biology

p-I-L-Phe4 human beta amyloid (1-40) (Echelon Product Code: 640-33 1MG)

p-I-L-Phe4 human beta amyloid (1-40) (Echelon Product Code: 640-33 1MG)
Description: Molecular Weight: 4453.16 Salt Form: TFA Purity: 95% Sequence (3-letter): Asp-Ala-Glu-pIPheArg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH Sequence (1-letter): DAE(pIPhe)RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH Storage: -20 °C or below
Order #: ECH-640-33-1MG
Unit Size: 1 mg
Supplier: Echelon Biosciences
Restrictions: Available in all European countries, except France & Italy.
Shipping: Room Temperature
Storage: -20 °C or below
Subcategory: Peptides
More information: Go to webpage
Flyer or Brochure
Add to request list
    MoBiTec is now part of BIOZOL

    All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
    You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.

    Technical Service - Product Information
Viewed