| Description: | CAS Number: 131438-79-4 Molecular Weight: 4327.18 Salt Form: TFA Purity: 96% Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH Sequence (1-letter): DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH Storage: -20 °C or below Solubility: water, 1mg/ml Beta amyloid (1-40), along with beta amyloid (1-42) (catalog # 641-15) is one of the two main variants of the amyloid " peptide involved in Alzheimer's disease. Beta amyloid (1-40) is a peptide that is found in plaques in the brains of patients with Alzheimer's disease and is shown to have both neurotrophic and neurotoxic effects in human and rat cell culture models. » References 1. Roher, A. et al. (1996) µMorphology and Toxicity of Ab-(1"42) Dimer Derived from Neuritic and Vascular Amyloid Deposits of Alzheimer"s Disease" J. Biol. Chem. 34: 20631"20635. 2.Tennent, G.A., Lovat, L.B. and Pepys, M.B. (1995) "Serum amyloid P component prevents proteolysis of the amyloid fibrils of Alzheimer disease and systemic amyloidosis" Proc. Natl. Acad. Sci. USA 92: 4299-4303. 3. Strittmatter, W.J. et at (1993) "Apolipoprotein E: High-avidity binding to , B-amyloid and increased frequency of type 4 allele in late-onset familial Alzheimer disease" Proc. Natl. Acad. Sci. USA 90: 1977-1981. 4. Scheuner, D. et al (1996) "Secreted amyloid bold "-protein similar to that in the senile plaques of Alzheimer's disease is increased in vivo by the presenilin 1 and 2 and APP mutations linked to familial Alzheimer's disease" Nat. Med. 2: 864 " 870. |
| Order #: | ECH-641-10-0.5MG |
| Unit Size: | 0.5 mg |
| Supplier: | Echelon Biosciences |
| Restrictions: | Available in all European countries, except France & Italy. |
| Shipping: | Room Temperature |
| Storage: | -20 °C or below |
| Subcategory: | Peptides |
| More information: | Go to webpage |
Add to request list
- Phone: +49 (0)89 3799666-6
- E-mail: info@biozol.de
MoBiTec is now part of BIOZOL
All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.
Technical Service - Product Information
Viewed