Description: | Molecular Weight: 4309.22 Salt Form: TFA Purity: 96% Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Nle-Val-Gly-Gly-Val-Val-OH Sequence (1-letter): DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL(Nle)VGGVV-OH Storage: -20 °C or below Beta amyloid (1-40), along with beta amyloid (1-42), is one of the two main variants of the amyloid " peptide involved in Alzheimer"s disease. Beta amyloid (1-40) is a peptide that is found in plaques in the brains of patients with Alzheimer"s disease and is shown to have both neurotrophic and neurotoxic effects in human and rat cell culture models. This analog has Nle instead of Met at position 35 resulting in a peptide that has the same propensity to aggregate but is non-toxic to hippocampal neurons. |
Order #: | ECH-641-13-5MG |
Unit Size: | 5 mg |
Supplier: | Echelon Biosciences |
Restrictions: | Available in all European countries, except France & Italy. |
Shipping: | Room Temperature |
Storage: | -20 °C or below |
Subcategory: | Peptides |
More information: | Go to webpage |
Add to request list
- Phone: +49 (0)89 3799666-6
- E-mail: info@biozol.de
MoBiTec is now part of BIOZOL
All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.
Technical Service - Product Information
Viewed