mobitec-globe Innovative Tools for Molecular and Cell Biology

Beta Amyloid (1-40), human [Gly22] (Arctic mutation) (Echelon Product Code: 641-14 0.5MG)

Beta Amyloid (1-40), human [Gly22] (Arctic mutation) (Echelon Product Code: 641-14 0.5MG)
Description: CAS Number: 175010-18-1 Molecular Weight: 4255.16 Salt Form: TFA Purity: 95% Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gly-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH Sequence (1-letter): DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV-OH Storage: -20 °C or below Beta Amyloid (1-40), human [Gly22] (Arctic mutation) causes early onset of Alzheimer"s compared to wild type and promotes protofibril formation and neurotoxicity.Beta amyloid (1-40), along with beta amyloid (1-42) (catalog # 641-15) is one of the two main variants of the amyloid " peptide involved in Alzheimer"s disease. Beta amyloid (1-40) is a peptide that is found in plaques in the brains of patients with Alzheimer"s disease and is shown to have both neurotrophic and neurotoxic effects in human and rat cell culture models.
Order #: ECH-641-14-0.5MG
Unit Size: 0.5 mg
Supplier: Echelon Biosciences
Restrictions: Available in all European countries, except France & Italy.
Shipping: Room Temperature
Storage: -20 °C or below
Subcategory: Peptides
More information: Go to webpage
Flyer or Brochure Product Image
Add to request list
    MoBiTec is now part of BIOZOL

    All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
    You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.

    Technical Service - Product Information
Viewed