| Description: | CAS Number: 144409-98-3 Molecular Weight: 4231.14 Salt Form: TFA Purity: 95% Sequence (3-letter): Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH Sequence (1-letter): DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH Storage: -20 °C or below Beta Amyloid (1-40), rat is a form of the amyloid "-peptide found in plaques associated with Alzheimer's disease. It has both neurotrophic and neurotoxic effects and may affect synaptic plasticity. |
| Order #: | ECH-642-10-1MG |
| Unit Size: | 1 mg |
| Supplier: | Echelon Biosciences |
| Restrictions: | Available in all European countries, except France & Italy. |
| Shipping: | Room Temperature |
| Storage: | -20 °C or below |
| Subcategory: | Peptides |
| More information: | Go to webpage |
Add to request list
- Phone: +49 (0)89 3799666-6
- E-mail: info@biozol.de
MoBiTec is now part of BIOZOL
All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.
Technical Service - Product Information
Viewed