Description: | Molecular Weight: 4510.32 Salt Form: TFA Purity: 95% Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH Sequence (1-letter): DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIA-OH Storage: -20 °C or below Beta Amyloid [Gln 22] (1-42) contains the E22Q mutation, a point mutation that substitutes glutamine for glutamic acid at position 22, also known as the "Dutch" mutant. The E22Q mutation leads to increased deposition rates of the A"E22Q peptide onto preseeded fibrils and is associated with greater toxicity. |
Order #: | ECH-642-30-0.5MG |
Unit Size: | 0.5 mg |
Supplier: | Echelon Biosciences |
Restrictions: | Available in all European countries, except France & Italy. |
Shipping: | Room Temperature |
Storage: | -20 °C or below |
Subcategory: | Peptides |
More information: | Go to webpage |
Add to request list
- Phone: +49 (0)89 3799666-6
- E-mail: info@biozol.de
MoBiTec is now part of BIOZOL
All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.
Technical Service - Product Information
Viewed