mobitec-globe Innovative Tools for Molecular and Cell Biology

Beta Amyloid [Gln 22] (1-42), human (Echelon Product Code: 642-30 1MG)

Beta Amyloid [Gln 22] (1-42), human (Echelon Product Code: 642-30 1MG)
Description: Molecular Weight: 4510.32 Salt Form: TFA Purity: 95% Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH Sequence (1-letter): DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIA-OH Storage: -20 °C or below Beta Amyloid [Gln 22] (1-42) contains the E22Q mutation, a point mutation that substitutes glutamine for glutamic acid at position 22, also known as the "Dutch" mutant. The E22Q mutation leads to increased deposition rates of the A"E22Q peptide onto preseeded fibrils and is associated with greater toxicity.
Order #: ECH-642-30-1MG
Unit Size: 1 mg
Supplier: Echelon Biosciences
Restrictions: Available in all European countries, except France & Italy.
Shipping: Room Temperature
Storage: -20 °C or below
Subcategory: Peptides
More information: Go to webpage
Flyer or Brochure Product Image
Add to request list
    MoBiTec is now part of BIOZOL

    All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
    You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.

    Technical Service - Product Information
Viewed