| Description: | CAS Number: 83930-33-0 Molecular Weight: 4866.46 Salt Form: TFA Purity: 95% Sequence (3-letter): Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2 Sequence (1-letter): NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2 Storage: -20 °C or below Urotensin I, suckerfish, is related to mammalian urocortin and is involved in the regulation of cortisol and stress responses in teleost fish (e.g. suckerfish or white sucker). It releases ACTH from cultured mammalian cells by binding to CRF1 and CRF2 receptors. |
| Order #: | ECH-817-30-1MG |
| Unit Size: | 1 mg |
| Supplier: | Echelon Biosciences |
| Restrictions: | Available in all European countries, except France & Italy. |
| Shipping: | Room Temperature |
| Storage: | -20 °C or below |
| Subcategory: | Peptides |
| More information: | Go to webpage |
Add to request list
- Phone: +49 (0)89 3799666-6
- E-mail: info@biozol.de
MoBiTec is now part of BIOZOL
All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.
Technical Service - Product Information
Viewed