Calmodulin Kinase II Inhibitor (281-309) (Echelon Product Code: 893-40 1MG)
| Description: | CAS Number: 116826-37-0 Molecular Weight: 3371.86 Salt Form: Acetate Purity: 96% Sequence (3-letter): Met-His-Arg-Gln-Glu-Thr-Val-Asp-Cys-Leu-Lys-Lys-Phe-Asn-Ala-Arg-Arg-Lys-Leu-Lys-Gly-Ala-Ile-Leu-Thr-Thr-Met-Leu-Ala-OH Sequence (1-letter): MHRQETVDCLKKFNARRKLKGAILTTMLA-OH Storage: -20 °C or below Calmodulin Kinase II Inhibitor (281-309) [CaMKII(281-309)] is a peptide fragment containing the calmodulin binding site (290-309) and the phosphorylation site (Thr286). CaMKII(281-309). It is useful as a calmodulin binding peptide and can act as an inhibitor of CaM kinase II (IC(50)= 80 nM) by blocking Ca(2+)/calmodulin activation and enzyme active site. Alternative name: Calmodulin Dependent Protein Kinase II (281-309) » References Waxham MN, Aronowski J (1993) "Ca2+/calmodulin-dependent protein kinase II is phosphorylated by protein kinase C in vitro". Biochemistry 32(11):2923-30; |
| Order #: | ECH-893-40-1MG |
| Unit Size: | 1 mg |
| Supplier: | Echelon Biosciences |
| Restrictions: | Available in all European countries, except France & Italy. |
| Shipping: | Room Temperature |
| Storage: | -20 °C or below |
| Subcategory: | Peptides |
| More information: | Go to webpage |
Add to request list
- Phone: +49 (0)89 3799666-6
- E-mail: info@biozol.de
MoBiTec is now part of BIOZOL
All orders and requests placed via the online shop on www.mobitec.com are processed by BIOZOL Diagnostica Vertrieb GmbH.
You will receive an order confirmation by fax or e-mail. More information regarding the ordering process can be found here.
Technical Service - Product Information
Viewed